Pfam domain
Pfam family: SWIRM-assoc_1 (PF16495.7)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 420-487
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQI
LDLNKSLE
Structures of the domain P43609 420-487
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v92 X-ray 20 K 398-487 None


© NPIDB team 2003 - 2021

text