Pfam domain
Pfam family: SWIRM (PF04433.19)
Uniprot AC: P43609
RecName: Chromatin structure-remodeling complex protein RSC8
Begin-End: 83-168
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAV
RRNVAMDVASIVKIHAFLEKWGLINY
Structures of the domain P43609 83-168
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 D 83-168 None
6kw4 X-ray 7.55 H 83-168 None
6kw3 X-ray 7.13 D 83-168 None
6kw3 X-ray 7.13 H 55-168 None
6kw5 X-ray 10.13 D 83-168 None
6kw5 X-ray 10.13 H 83-168 None
6tda X-ray 15 L 83-168 None
6tda X-ray 15 L 1083-1168 None
6v92 X-ray 20 L 83-168 None
6v92 X-ray 20 I 83-168 None


© NPIDB team 2003 - 2021

text