Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P44558
RecName: Uncharacterized HTH-type transcriptional regulator HI_0186
Begin-End: 4-72
Organism: Haemophilus influenzae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
TTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGMSLK
DIKRFAECT
Structures of the domain P44558 4-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d8c X-ray 2.25 A 3-71  H-Bb H-Mj L-Bb 
5d8c X-ray 2.25 B 3-71  H-Bb H-Mj L-Bb L-Mn 
5e01 X-ray 2.3 A 3-71  H-Bb H-Mj L-Bb 
5e01 X-ray 2.3 B 3-71  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text