Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: P45870
RecName: Chromosome-anchoring protein RacA
Begin-End: 1-65
Organism: Bacillus subtilis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
MNTNMVASELGVSAKTVQRWVKQLNLPAERNELGHYSFTAEDVKVLKSVQKQISEGTAIQ
DIHLP
Structures of the domain P45870 1-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5i44 X-ray 2.62 E 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 B 5-68  H-Bb H-Mj S-Bb 
5i44 X-ray 2.62 D 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 A 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 K 3-66  H-Bb H-Mj L-Bb 
5i44 X-ray 2.62 J 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 H 1-64  H-Bb H-Mj L-Bb 
5i44 X-ray 2.62 I 1-64  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 F 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 G 3-66  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 E 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 D 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 A 5-68  H-Bb H-Mj S-Bb L-Bb 
5i44 X-ray 2.62 B 5-68  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2021

text