Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P46063
RecName: ATP-dependent DNA helicase Q1
Begin-End: 93-264
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLK
QLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARR
FTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTD
Structures of the domain P46063 93-264
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwy X-ray 2.9 B 93-264 None
2wwy X-ray 2.9 A 93-264 None
4u7d X-ray 3.4 C 93-264 None
4u7d X-ray 3.4 D 93-264 None
4u7d X-ray 3.4 B 93-264 None
4u7d X-ray 3.4 A 93-264 None


© NPIDB team 2003 - 2021

text