Pfam domain
Pfam family: RPA43_OB (PF17875.3)
Uniprot AC: P46669
RecName: DNA-directed RNA polymerase I subunit RPA43
Begin-End: 103-151
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHD
Structures of the domain P46669 103-151
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 G 127-214 None


© NPIDB team 2003 - 2021

text