Pfam domain
Pfam family: RPA43_OB (PF17875.3)
Uniprot AC: P46669
RecName: DNA-directed RNA polymerase I subunit RPA43
Begin-End: 121-169
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFV
Structures of the domain P46669 121-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m64 X-ray 4.6 G 127-214 None
5w5y X-ray 3.8 G 127-214 None
6rrd X-ray 3.1 G 127-214 None
5m5w X-ray 3.8 G 127-214 None
5m5y X-ray 4 G 127-214 None
5w66 X-ray 3.9 G 127-214 None
5w65 X-ray 4.3 G 127-214 None
5oa1 X-ray 4.4 G 127-214 None
6rqt X-ray 4 G 127-214 None
6h68 X-ray 4.6 G 127-214 None
6rui X-ray 2.7 G 127-214 None
5w64 X-ray 4.2 G 127-214 None


© NPIDB team 2003 - 2021

text