Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.19)
Uniprot AC: P46669
RecName: DNA-directed RNA polymerase I subunit RPA43
Begin-End: 44-112
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEK
LIKITPDTP
Structures of the domain P46669 44-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 G 44-112 None
6tps X-ray 3.54 G 44-112 None
5m64 X-ray 4.6 G 44-112 None
5w5y X-ray 3.8 G 44-112 None
6ruo X-ray 3.5 G 44-112 None
6rrd X-ray 3.1 G 44-112 None
6rql X-ray 2.9 G 44-112 None
5n61 X-ray 3.4 G 44-112 None
5m5w X-ray 3.8 G 44-112 None
5m5y X-ray 4 G 44-112 None
5m3f X-ray 3.8 G 44-112 None
6h67 X-ray 3.6 G 44-112 None
5w66 X-ray 3.9 G 44-112 None
5w65 X-ray 4.3 G 44-112 None
5oa1 X-ray 4.4 G 44-112 None
6hko X-ray 3.42 G 44-112 None
6rqt X-ray 4 G 44-112 None
6h68 X-ray 4.6 G 44-112 None
6rqh X-ray 3.7 G 44-112 None
6rwe X-ray 3 G 44-112 None
6hlq X-ray 3.18 G 44-112 None
6rui X-ray 2.7 G 44-112 None
6hlr X-ray 3.18 G 44-112 None
5w64 X-ray 4.2 G 44-112 None


© NPIDB team 2003 - 2021

text