Pfam domain
Pfam family: Myb_DNA-bind_7 (PF15963.7)
Uniprot AC: P46678
RecName: Transcription factor TFIIIB component B''
Begin-End: 143-230
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSFKPSFLDSSSNSNGTARRLSTISNKLPKKIRLGSITENDMNLKTFKRHRVLGKPSSAK
KPAGAHRISIVSKISPPTAMTDSLDRNE
Structures of the domain P46678 143-230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 V 410-497  H-Bb 


© NPIDB team 2003 - 2021

text