Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P46781
RecName: 40S ribosomal protein S9
Begin-End: 108-154
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQ
Structures of the domain P46781 108-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zvh X-ray 2.9 J 108-154 None
6g51 X-ray 4.1 J 108-154 None
6g4w X-ray 4.5 J 108-154 None
7k5i X-ray 2.9 J 108-154 None
6zok X-ray 2.8 J 108-154 None
6zxe X-ray 3 J 108-154 None
6g53 X-ray 4.5 J 108-154 None
5a2q X-ray 3.9 J 108-154 None
6g5h X-ray 3.6 J 108-154 None
6zxd X-ray 3.2 J 108-154 None
5flx X-ray 3.9 J 108-154 None
6g4s X-ray 4 J 108-154 None
6g18 X-ray 3.6 J 108-154 None
6g5i X-ray 3.5 J 108-154 None
5oa3 X-ray 4.3 J 108-154 None
6ybw X-ray 3.1 D 108-154 None
6zmt X-ray 3 J 108-154 None
6zoj X-ray 2.8 J 108-154 None
6zn5 X-ray 3.2 J 108-154 None
6zlw X-ray 2.6 J 108-154 None
6zxg X-ray 2.6 J 108-154 None
6zxh X-ray 2.7 J 108-154 None
6zxf X-ray 3.7 J 108-154 None


© NPIDB team 2003 - 2021

text