Pfam domain
Pfam family: RNA_polI_A34 (PF08208.13)
Uniprot AC: P47006
RecName: DNA-directed RNA polymerase I subunit RPA34
Begin-End: 49-180
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KQQQVWLIKFPSNVDISKLKSLPVDFESSTTMTIDKHDYKIMDDTDIESSLTQDNLSNMT
LLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDVPKVEGLKL
EHFATGYDAEDF
Structures of the domain P47006 49-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 N 44-177 None
6tps X-ray 3.54 N 41-180 None
5m64 X-ray 4.6 N 44-177 None
5w5y X-ray 3.8 N 48-180 None
6ruo X-ray 3.5 N 44-180 None
6rrd X-ray 3.1 N 44-180 None
6rql X-ray 2.9 N 44-180 None
5n61 X-ray 3.4 N 41-180 None
5m5w X-ray 3.8 N 44-180 None
5m5y X-ray 4 N 44-177 None
5m3f X-ray 3.8 N 41-180 None
6h67 X-ray 3.6 N 40-180 None
5w66 X-ray 3.9 N 48-180 None
5w65 X-ray 4.3 N 48-180 None
5oa1 X-ray 4.4 N 44-180 None
6rqt X-ray 4 N 44-177 None
6h68 X-ray 4.6 N 48-180 None
6rqh X-ray 3.7 N 44-180 None
6rwe X-ray 3 N 44-180 None
6rui X-ray 2.7 N 44-180 None
5w64 X-ray 4.2 N 48-180 None


© NPIDB team 2003 - 2021

text