Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.18)
Uniprot AC: P47076
RecName: DNA-directed RNA polymerase III subunit RPC9
Begin-End: 10-161
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSIN
KNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPA
NMVHLYSIVEECDARFDEKTIEEMLEIISGYA
Structures of the domain P47076 10-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 D 10-160 None
5fj8 X-ray 3.9 D 10-160 None
6cnc X-ray 4.1 D 10-160 None
6f44 X-ray 4.2 D 10-160 None
6f41 X-ray 4.3 D 10-160 None
6cnf X-ray 4.5 D 10-160 None
6eu1 X-ray 3.4 D 10-160 None
6f40 X-ray 3.7 D 10-160 None
6cnb X-ray 4.1 D 10-160 None
6f42 X-ray 5.5 D 10-160 None
6cnd X-ray 4.8 D 10-160 None


© NPIDB team 2003 - 2021

text