Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P49450
RecName: Histone H3-like centromeric protein A
Begin-End: 42-133
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAF
LVHLFEDAYLLTLHAGRVTLFPKDVQLARRIR
Structures of the domain P49450 42-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6se0 X-ray 3.8 A 42-133 None
6se0 X-ray 3.8 E 42-133 None
6se6 X-ray 3.5 E 42-133 None
6se6 X-ray 3.5 A 42-133 None
6see X-ray 4.2 A 42-133 None
6see X-ray 4.2 E 42-133 None
6sef X-ray 3.7 A 42-133 None
6sef X-ray 3.7 E 42-133 None
6e0p X-ray 2.6 A 42-133  H-Bb H-Mj S-Bb L-Bb 
6e0p X-ray 2.6 E 42-133  H-Bb H-Mj S-Bb L-Bb 
6e0c X-ray 2.63 E 42-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
6e0c X-ray 2.63 A 42-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
6l49 X-ray 18.9 A 46-133 None
6seg X-ray 3.1 E 45-133 None
6seg X-ray 3.1 A 45-133 None
6o1d X-ray 3.4 E 42-133  H-Bb H-Mj S-Bb L-Bb 
6o1d X-ray 3.4 A 42-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
6mup X-ray 3.5 E 39-133 None
6mup X-ray 3.5 A 38-133 None
6muo X-ray 3.6 E 41-133 None
6muo X-ray 3.6 A 41-133 None


© NPIDB team 2003 - 2021

text