Pfam domain
Pfam family: LIM (PF00412.24)
Uniprot AC: P49711
RecName: Transcriptional repressor CTCF
Begin-End: 521-570
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTM
Structures of the domain P49711 521-570
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5yel X-ray 2.96 A 525-576  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text