Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P49735
RecName: DNA replication licensing factor Mcm2
Begin-End: 181-272
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
ANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQM
LEIFDKVAKDMVLSIFPTYERVTTEIHVRISE
Structures of the domain P49735 181-272
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 2 181-272 None
6ray X-ray 4.28 2 181-289 None
6raw X-ray 3.7 2 181-272 None
6raz X-ray 4.46 2 181-271 None


© NPIDB team 2003 - 2021

text