Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P49735
RecName: DNA replication licensing factor Mcm2
Begin-End: 445-668
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
DIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINL
LICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLA
DQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDP
SMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSH
Structures of the domain P49735 445-668
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 2 445-668 None
6ray X-ray 4.28 2 445-668 None
6raw X-ray 3.7 2 445-668 None
6raz X-ray 4.46 2 445-668 None


© NPIDB team 2003 - 2021

text