Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P49736
RecName: DNA replication licensing factor MCM2
Begin-End: 293-422
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSC
PECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEI
ELTGIYHNNY
Structures of the domain P49736 293-422
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 2 293-422 None


© NPIDB team 2003 - 2021

text