Pfam domain
Pfam family: Ets (PF00178.24)
Uniprot AC: P50548
RecName: ETS domain-containing transcription factor ERF
Begin-End: 28-107
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
QLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRY
YYNKRILHKTKGKRFTYKFN
Structures of the domain P50548 28-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jsa X-ray 2.85 J 28-107  H-Bb H-Mj S-Bb L-Bb 
7jsl X-ray 4.51 J 28-107  H-Bb H-Mj S-Bb L-Bb 
7jsl X-ray 4.51 E 28-107  H-Bb H-Mj S-Bb L-Bb 
7jsl X-ray 4.51 H 28-107  H-Bb H-Mj S-Bb L-Bb 
7jsl X-ray 4.51 L 28-107  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text