Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P50830
RecName: Uncharacterized ATP-dependent helicase YprA
Begin-End: 56-231
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
YTHQYSAFQYVQKGESIVTVTPTASGKTLCYNLPVLQSIAQDETNRALYLFPTKALAQDQ
KSELNEIIDEMGIDIKSFTYDGDTSPAIRQKVRKAGHIVITNPDMLHSAILPHHTKWVSL
FENLKYIVIDELHTYRGVFGSHVANVIRRLKRICRFYGSDPVFICTSATIANPKEL
Structures of the domain P50830 56-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6znp X-ray 3.16 B 56-231 None
6znp X-ray 3.16 A 56-231 None
6znq X-ray 3.34 A 56-231 None
6znq X-ray 3.34 B 56-231 None


© NPIDB team 2003 - 2021

text