Pfam domain
Pfam family: ORC5_C (PF14630.8)
Uniprot AC: P50874
RecName: Origin recognition complex subunit 5
Begin-End: 335-421
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIF
PIQGKAESGSLSALREESLMKANIEVF
Structures of the domain P50874 335-421
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wgg X-ray 8.1 E 372-474  L-Bb 
6wgi X-ray 10 E 372-474  L-Bb 
5v8f X-ray 3.9 E 372-474 None
6wgc X-ray 4.3 E 372-474  L-Bb 


© NPIDB team 2003 - 2021

text