Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P51532
RecName: Transcription activator BRG1
Begin-End: 757-1052
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLS
NWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWK
YMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSC
STFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMF
Structures of the domain P51532 757-1052
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ltj X-ray 3.7 I 757-979 None


© NPIDB team 2003 - 2021

text