Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: P52026
RecName: DNA polymerase I
Begin-End: 497-874
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
TKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTGYST
SADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQALTQTGRL
SSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIAEDDNLIEAFR
RGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFI
ERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPI
QGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEEIERLCRLVPEVMEQAV
TLRVPLKVDYHYGPTWYD
Structures of the domain P52026 497-874
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ua1 X-ray 2 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4bdp X-ray 1.8 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1lv5 X-ray 1.95 B 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
1lv5 X-ray 1.95 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2bdp X-ray 1.8 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
3bdp X-ray 1.9 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1l3s X-ray 1.7 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1nk8 X-ray 1.9 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1u4b X-ray 1.6 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
3eyz X-ray 2.1 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1l3v X-ray 1.71 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1nk4 X-ray 1.6 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1njy X-ray 2 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1njx X-ray 1.65 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1l5u X-ray 1.95 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1nk7 X-ray 1.9 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1xc9 X-ray 1.9 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1nk9 X-ray 1.9 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1nkc X-ray 1.8 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1nkb X-ray 2 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1l3u X-ray 1.8 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1u48 X-ray 2.1 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1u47 X-ray 2 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
1nk0 X-ray 1.7 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1u49 X-ray 2.15 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1l3t X-ray 1.7 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1nke X-ray 1.8 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
1u45 X-ray 2.01 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1njz X-ray 2 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
3ez5 X-ray 1.9 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
3ez5 X-ray 1.9 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1nk5 X-ray 2.1 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
1nk6 X-ray 2.1 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text