Pfam domain
Pfam family: MutS_I (PF01624.22)
Uniprot AC: P52701
RecName: DNA mismatch repair protein Msh6
Begin-End: 407-526
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 

Sequence:
TPGMRKWWQIKSQNFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAF
GRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV
Structures of the domain P52701 407-526
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o8f X-ray 3.25 B 407-526  H-Bb S-Bb S-Mj S-Mn L-Bb 
2o8b X-ray 2.75 B 407-526  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
2o8c X-ray 3.37 B 407-526  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
2o8d X-ray 3 B 407-526  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mn 
2o8e X-ray 3.3 B 407-526  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text