Pfam domain
Pfam family: MutS_IV (PF05190.20)
Uniprot AC: P52701
RecName: DNA mismatch repair protein Msh6
Begin-End: 932-1024
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
GFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLP
EEYELKSTKKGCKRYWTKTIEKKLANLINAEER
Structures of the domain P52701 932-1024
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o8f X-ray 3.25 B 933-1024  L-Bb 
2o8b X-ray 2.75 B 933-1024  L-Bb 
2o8c X-ray 3.37 B 933-1024  L-Bb 
2o8d X-ray 3 B 933-1024 None
2o8e X-ray 3.3 B 933-1024  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text