Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P52952
RecName: Homeobox protein Nkx-2.5
Begin-End: 139-193
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKC
Structures of the domain P52952 139-193
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s0h X-ray 2.82 F 105-157  H-Bb H-Mj L-Bb 
4s0h X-ray 2.82 B 142-194  H-Bb H-Mj L-Bb L-Mn 
6wc5 X-ray 2.9 I 142-195  H-Bb H-Mj 
6wc5 X-ray 2.9 N 140-194  H-Bb H-Mj 
6wc2 X-ray 2.1 O 145-195  H-Bb H-Mj 
6wc2 X-ray 2.1 M 142-195  H-Bb H-Mj 
6wc2 X-ray 2.1 N 142-194  H-Bb H-Mj L-Bb L-Mn 
3rkq X-ray 1.7 A 139-194  H-Bb H-Mj L-Bb L-Mn 
3rkq X-ray 1.7 B 139-192  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text