Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: P53010
RecName: PAN2-PAN3 deadenylation complex catalytic subunit PAN2
Begin-End: 907-1079
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VAIDAEFVSLQSELCEIDHQGIRSIIRPKRTALARISIIRGEEGELYGVPFVDDYVVNTN
HIEDYLTRYSGILPGDLDPEKSTKRLVRRNVVYRKVWLLMQLGCVFVGHGLNNDFKHINI
NVPRNQIRDTAIYFLQGKRYLSLRYLAYVLLGMNIQEGNHDSIEDAHTALILY
Structures of the domain P53010 907-1079
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r9o X-ray 3.32 A 907-1079 None
6r9m X-ray 3.33 A 907-1079 None
6r9p X-ray 2.98 A 907-1079 None
6r9j X-ray 3.33 A 907-1079 None
6r5k X-ray 4.8 A 907-1079 None
6r9q X-ray 3.08 A 907-1079 None


© NPIDB team 2003 - 2021

text