Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P53091
RecName: DNA replication licensing factor MCM6
Begin-End: 112-193
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
REAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAIS
EQYYRFLPFLQKGLRRVVRKYA
Structures of the domain P53091 112-193
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 6 112-329 None


© NPIDB team 2003 - 2021

text