Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P53091
RecName: DNA replication licensing factor MCM6
Begin-End: 275-405
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCP
NPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDR
CKFTGVEIVVP
Structures of the domain P53091 275-405
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f0l X-ray 4.77 E 275-405 None
6f0l X-ray 4.77 6 275-405 None
5u8t X-ray 4.9 6 275-405 None
6wgg X-ray 8.1 6 275-405 None
5u8s X-ray 6.1 6 275-405 None
5bk4 X-ray 3.9 6 275-405 None
5bk4 X-ray 3.9 E 275-405 None
6wgi X-ray 10 6 275-405 None
5v8f X-ray 3.9 6 275-405 None
6u0m X-ray 3.9 6 275-405 None
6hv9 X-ray 4.98 6 275-405 None


© NPIDB team 2003 - 2021

text