Pfam domain
Pfam family: MCM6_C (PF18263.3)
Uniprot AC: P53091
RecName: DNA replication licensing factor MCM6
Begin-End: 907-969
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIK
RLV
Structures of the domain P53091 907-969
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 6 834-969 None


© NPIDB team 2003 - 2021

text