Pfam domain
Pfam family: Rtt102p (PF09510.12)
Uniprot AC: P53330
RecName: Regulator of Ty1 transposition protein 102
Begin-End: 5-90
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWL
RNQEDEKNLQRESCEDILDLKEFDRR
Structures of the domain P53330 5-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 h 81-110 None
6kw3 X-ray 7.13 h 34-90 None
6uxw X-ray 8.96 Z 34-90 None
6kw5 X-ray 10.13 h 81-110 None
6tda X-ray 15 V 34-90 None
6v92 X-ray 20 P 34-90 None
6vz4 X-ray 3.9 N 34-90 None


© NPIDB team 2003 - 2021

text