Pfam domain
Pfam family: SWIB (PF02201.20)
Uniprot AC: P53628
RecName: Transcription regulatory protein SNF12
Begin-End: 63-138
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DHLAELIPELYSFQQLVDSEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNV
KFLRIFISNVSENQPW
Structures of the domain P53628 63-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uxw X-ray 8.96 H 307-411 None


© NPIDB team 2003 - 2021

text