Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P53762
RecName: Aryl hydrocarbon receptor nuclear translocator
Begin-End: 90-142
Organism: Mus musculus
Interaction Mode:   

Sequence:
ARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSL
Structures of the domain P53762 90-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4zpk X-ray 3.6 A 90-157  H-Bb H-Mj L-Bb 
5sy7 X-ray 4.2 A 90-156  H-Bb H-Mj L-Bb 
4zpr X-ray 3.9 A 90-160  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text