Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: P54041
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
DPLANALNHISNCERVGKKVVYIKPASKLIGRVLKVMQDNGYIGEFEFIEDGRAGIFKVE
LIGKINKCGAIKPRFPVKKFGYEKFEKRYLPARDFGILIVSTTQGVMSHEEAKKRGLGGR
LLAYVY
Structures of the domain P54041 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i6u X-ray 2.6 A 5-130 None
1i6u X-ray 2.6 B 5-130 None


© NPIDB team 2003 - 2021

text