Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.28)
Uniprot AC: P54066
RecName: 50S ribosomal protein L7Ae
Begin-End: 12-106
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
EIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIP
YAYVASKQDLGKAAGLEVAASSVAIINEGDAEELK
Structures of the domain P54066 12-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k0a X-ray 4.6 I 12-106 None
6k0a X-ray 4.6 J 12-106 None
1sds X-ray 1.8 C 12-106 None
1sds X-ray 1.8 B 12-106 None
1sds X-ray 1.8 A 12-106 None
6k0b X-ray 4.3 J 12-106 None
6k0b X-ray 4.3 I 12-106 None


© NPIDB team 2003 - 2021

text