Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: P54098
RecName: DNA polymerase subunit gamma-1
Begin-End: 755-1188
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVV
WLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSEL
KAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSK
TATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRW
YRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTE
SEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLV
AMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLP
QSVAFFSAVDIDRC
Structures of the domain P54098 755-1188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ztz X-ray 3.44 A 755-1188  H-Bb L-Bb L-Mn 
5c53 X-ray 3.57 A 755-1188  H-Bb L-Bb L-Mn 
4ztu X-ray 3.3 A 755-1188  H-Bb L-Bb L-Mn 
5c51 X-ray 3.43 A 755-1188  H-Bb S-Bb L-Bb L-Mn 
5c52 X-ray 3.64 A 755-1188  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text