Pfam domain
Pfam family: BAH (PF01426.20)
Uniprot AC: P54784
RecName: Origin recognition complex subunit 1
Begin-End: 48-188
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNP
DANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDP
ERDFTVRYICEPTGEKFVDIN
Structures of the domain P54784 48-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6om3 X-ray 3.3 L 48-188 None
6om3 X-ray 3.3 K 48-188 None
6om3 X-ray 3.3 W 48-188 None


© NPIDB team 2003 - 2021

text