Pfam domain
Pfam family: ORC4_C (PF14629.8)
Uniprot AC: P54791
RecName: Origin recognition complex subunit 4
Begin-End: 286-517
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLV
ATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGS
FNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQ
LDFFTEKSAVGLRDNATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRII
Structures of the domain P54791 286-517
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 D 287-516  H-Bb H-Mj L-Bb L-Mj 
6wgg X-ray 8.1 D 287-516  H-Bb H-Mj L-Bb 
6wgi X-ray 10 D 287-516  H-Bb L-Bb 
5v8f X-ray 3.9 D 287-516  H-Mj 
6wgc X-ray 4.3 D 287-516  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text