Pfam domain
Pfam family: AAA_22 (PF13401.8)
Uniprot AC: P54791
RecName: Origin recognition complex subunit 4
Begin-End: 52-181
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LQRRLLQQLYGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYL
LDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLET
ISSGSLTEVF
Structures of the domain P54791 52-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 D 96-253 None
6wgg X-ray 8.1 D 96-253 None
6wgi X-ray 10 D 96-253 None
5v8f X-ray 3.9 D 96-253 None
6wgc X-ray 4.3 D 96-253 None


© NPIDB team 2003 - 2021

text