Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P54999
RecName: Small nuclear ribonucleoprotein F
Begin-End: 6-66
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSH
G
Structures of the domain P54999 6-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ylz X-ray 3.6 J 13-73 None
5y88 X-ray 3.7 J 16-78 None


© NPIDB team 2003 - 2021

text