Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: P55265
RecName: Double-stranded RNA-specific adenosine deaminase
Begin-End: 135-199
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
IYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPL
WKIAV
Structures of the domain P55265 135-199
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3f21 X-ray 2.2 A 135-199 None
3f21 X-ray 2.2 C 135-197 None
3f22 X-ray 2.5 A 135-198 None
3f22 X-ray 2.5 C 135-199 None
3f23 X-ray 2.7 A 135-198 None
3f23 X-ray 2.7 C 135-199 None
1qbj X-ray 2.1 C 135-199 None
1qbj X-ray 2.1 B 136-198  H-Bb H-Mj S-Bb 
1qbj X-ray 2.1 A 135-198  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text