Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: P55265
RecName: Double-stranded RNA-specific adenosine deaminase
Begin-End: 140-196
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWK
Structures of the domain P55265 140-196
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zu1 X-ray 3.01 B -3-196  H-Bb H-Mj 
5zuo X-ray 2.9 D -3-199  H-Bb H-Mj 
5zuo X-ray 2.9 C -3-200  H-Bb H-Mj 
5zuo X-ray 2.9 A -2-199  H-Bb H-Mj 
5zup X-ray 2.9 D -3-199  H-Bb H-Mj 
5zup X-ray 2.9 A -1-199  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text