Pfam domain
Pfam family: Forkhead (PF00250.20)
Uniprot AC: P55316
RecName: Forkhead box protein G1
Begin-End: 180-266
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCF
VKVPRHYDDPGKGNYWMLDPSSDDVFI
Structures of the domain P55316 180-266
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7cby X-ray 1.65 C 180-266  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text