Pfam domain
Pfam family: DNA_pol_B (PF00136.23)
Uniprot AC: P56689
RecName: DNA polymerase
Begin-End: 344-748
Organism: Thermococcus gorgonarius
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VSRSSTGNLVEWFLLRKAYERNELAPNKPDERELARRRESYAGGYVKEPERGLWENIVYL
DFRSLYPSIIITHNVSPDTLNREGCEEYDVAPQVGHKFCKDFPGFIPSLLGDLLEERQKV
KKKMKATIDPIEKKLLDYRQRAIKILANSFYGYYGYAKARWYCKECAESVTAWGRQYIET
TIREIEEKFGFKVLYADTDGFFATIPGADAETVKKKAKEFLDYINAKLPGLLELEYEGFY
KRGFFVTKKKYAVIDEEDKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIV
KEVTEKLSKYEVPPEKLVIYEQITRDLKDYKATGPHVAVAKRLAARGIKIRPGTVISYIV
LKGSGRIGDRAIPFDEFDPAKHKYDAEYYIENQVLPAVERILRAF
Structures of the domain P56689 344-748
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vwj X-ray 2.78 A 344-748  H-Bb L-Bb L-Mn 
2xhb X-ray 2.72 A 344-748  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text