Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P60240
RecName: RNA polymerase-associated protein RapA
Begin-End: 159-472
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LNIAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVE
MLRRFNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLV
VDEAHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHD
FAQFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQS
ARQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
SAEDRARDMLYPER
Structures of the domain P60240 159-472
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s20 X-ray 4.7 K 159-472 None
4s20 X-ray 4.7 L 159-472 None


© NPIDB team 2003 - 2021

text