Pfam domain
Pfam family: Tudor_RapA (PF18337.3)
Uniprot AC: P60240
RecName: RNA polymerase-associated protein RapA
Begin-End: 55-118
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDSKLVFSKPQDR
LFAG
Structures of the domain P60240 55-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s20 X-ray 4.7 K 55-118 None
4s20 X-ray 4.7 L 55-118 None


© NPIDB team 2003 - 2021

text