Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.11)
Uniprot AC: P60281
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 507-573
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
YRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVEFVSADQ
VDYMDVS
Structures of the domain P60281 507-573
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dcf X-ray 3.45 C 507-571 None
6ccv X-ray 3.05 C 507-573 None
6vvt X-ray 2.9 C 507-573 None
5vi5 X-ray 3.2 C 507-573 None
6cce X-ray 3.05 C 507-573 None
5vi8 X-ray 2.76 C 507-573 None
5tw1 X-ray 2.76 C 507-573 None
6vvs X-ray 3.11 C 507-573 None


© NPIDB team 2003 - 2021

text