Pfam domain
Pfam family: Ribosomal_L2 (PF00181.25)
Uniprot AC: P60422
RecName: 50S ribosomal protein L2
Begin-End: 42-118
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRNNNGRITTRHIGGGHKQAYRIVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGER
RYILAPKGLKAGDQIQS
Structures of the domain P60422 42-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pc7 X-ray 2.5 K 42-118 None
6pct X-ray 2.8 K 42-118 None
5aka X-ray 5.7 C 41-117 None
6pch X-ray 2.9 K 42-118 None
6pcs X-ray 2.8 K 42-118 None
6i0y X-ray 3.2 C 41-117 None
5gaf X-ray 4.3 C 42-118 None
6gbz X-ray 3.8 C 41-117 None
6gc4 X-ray 4.3 C 41-117 None
6ys3 X-ray 2.58 c 42-118 None
6pc8 X-ray 2.9 K 42-118 None
3j5l X-ray 6.6 C 41-117 None
3j7z X-ray 3.9 C 41-117 None
6s0k X-ray 3.1 C 42-118 None
6gc8 X-ray 3.8 C 41-117 None
5gae X-ray 3.33 C 42-118 None
4csu X-ray 5.5 C 41-117 None
3j8g X-ray 5 C 41-117 None
7bv8 X-ray 3.14 C 42-118 None
6xz7 X-ray 2.1 C 41-118 None
5gag X-ray 3.8 C 42-118 None
5ady X-ray 4.5 C 41-117 None
4uy8 X-ray 3.8 C 41-117 None
2rdo X-ray 9.1 C 41-117 None
6gc0 X-ray 3.8 C 41-117 None
3bbx X-ray 10 C 41-117 None
2j28 X-ray 8 C 41-117 None
5gah X-ray 3.8 C 44-118 None
5gad X-ray 3.7 C 44-118 None
6qul X-ray 3 C 44-118 None
6wnt X-ray 3.1 b 41-117 None
6pc5 X-ray 2.7 K 42-118 None
6pcq X-ray 2.6 K 42-118 None
6pcr X-ray 2.5 K 42-118 None
6qdw X-ray 2.83 c 42-118 None
6pc6 X-ray 2.5 K 42-118 None
6wyv X-ray 2.75 K 42-118 None


© NPIDB team 2003 - 2021

text