Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P60842
RecName: Eukaryotic initiation factor 4A-I
Begin-End: 56-223
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQ
IQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKY
IKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEV
Structures of the domain P60842 56-223
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zc9 X-ray 2 A 56-223 None


© NPIDB team 2003 - 2021

text