Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.18)
Uniprot AC: P60899
RecName: DNA-directed RNA polymerase II subunit RPB9
Begin-End: 14-51
Organism: Sus scrofa
Interaction Mode:   

Sequence:
IRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS
Structures of the domain P60899 14-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 I 14-51 None
6gmh X-ray 3.1 I 14-51 None
6exv X-ray 3.6 I 14-51 None
6ted X-ray 3.1 I 14-51 None


© NPIDB team 2003 - 2021

text