Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P61244
RecName: Protein max
Begin-End: 24-75
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMR
Structures of the domain P61244 24-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1an2 X-ray 2.9 A 24-75 None
1hlo X-ray 2.8 B 14-65  H-Bb H-Mj 
1hlo X-ray 2.8 A 14-65  H-Bb H-Mj 
1nkp X-ray 1.8 E 704-754  H-Bb H-Mj 
1nkp X-ray 1.8 B 203-254  H-Bb H-Mj 
5eyo X-ray 2.39 A 24-75 None
5eyo X-ray 2.39 C 24-75 None
1nlw X-ray 2 B 203-254  H-Bb H-Mj L-Bb 
1nlw X-ray 2 E 705-754  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text